Antimicrobial Resistance: Genomic Perspective
Exploring AMR Databases, Genome-based Resistance Tools, and Analytical Workflows for Research and Clinical Use
  • Understand the global burden and regional disparities of AMR
  • Identify the six major resistance mechanisms at the molecular level
  • Recognize the role of mobile genetic elements in resistance spread
  • Master practical AMR detection using AMRFinderPlus, RGI, and ABRicate
  • Integrate virulence factor prediction for complete pathogen profiling
Start Hands-on
The Escalating Threat of Antimicrobial Resistance (AMR)
Antimicrobial Resistance occurs when microbes—including bacteria, viruses, fungi, and parasites—develop sophisticated mechanisms to withstand antimicrobial medicines, rendering previously effective treatments ineffective. This evolutionary adaptation represents one of the most critical challenges facing modern medicine and global public health infrastructure.

World Health Organization (WHO)
1.27 Million Deaths
Bacterial AMR was directly responsible for this many global deaths in 2019 alone
4.95 Million Deaths
Additional deaths to which AMR contributed as a significant factor
10 Million Projected Deaths
Annual deaths by 2050 without intervention
Critical Impacts
  • Economic burden: $100 trillion cumulative by 2050
  • Threatens modern medical procedures including surgery, chemotherapy, and organ transplants
  • Undermines decades of progress in treating infectious diseases
  • Disproportionately affects vulnerable populations in low-resource settings
Review on Antimicrobial Resistance, 2014
The landmark 2014 Review on Antimicrobial Resistance, commissioned by the UK government and chaired by economist Jim O'Neill, provided the first comprehensive global analysis of the AMR crisis and its projected economic and health impacts.
Review on Antimicrobial Resistance, 2014 (Chaired by Jim O'Neill)
This comprehensive review, initiated in 2014, aimed to thoroughly assess the escalating global issue of rising drug resistance, understand its profound magnitude, and define concrete, actionable steps to address it effectively. The review culminated in an influential analysis published in 2016, which starkly forecasted that a staggering 10 million people could die annually from AMR by 2050 if no significant interventions were made.
Key Findings
  • Projected 10 million annual deaths by 2050 if no action taken
  • Economic cost could reach $100 trillion globally by mid-century
  • Current death toll: 700,000 annually (2014 estimate)
  • Drug-resistant infections already causing significant mortality in all regions
Major Recommendations
  • Massive reduction in unnecessary antibiotic use in agriculture
  • Global public awareness campaigns
  • Improved hygiene and infection prevention
  • Development of rapid diagnostics
  • Economic incentives for new antibiotic development
  • International surveillance and coordination mechanisms

This review catalyzed global action including WHO's Global Action Plan on AMR and national AMR action plans worldwide.
"If we fail to act, we are looking at an almost unthinkable scenario where antimicrobials no longer work and we are cast back into the dark ages of medicine" – David Cameron, former UK Prime Minister
Regional AMR Surveillance and Priority Pathogens
AMR burden will be felt most acutely in Asian and African nations
Disproportionate Impact in Low and Middle-Income Countries (LMICs)
  • High baseline infectious disease prevalence (TB, malaria, HIV co-infections)
  • Widespread antimicrobial misuse and over-the-counter availability without prescription
  • Limited diagnostic infrastructure leading to empirical therapy overuse
  • Inadequate infection prevention and control measures in healthcare facilities
  • Poor sanitation infrastructure and contaminated water sources
  • High population density facilitating rapid transmission
  • Unregulated agricultural antibiotic use in livestock and aquaculture
  • Weak regulatory frameworks and enforcement mechanisms
Regional Surveillance Challenges
  • Fragmented data collection systems
  • Limited laboratory capacity for culture and susceptibility testing
  • Insufficient genomic surveillance infrastructure
  • Need for standardized reporting mechanisms
  • Integration with global surveillance networks (WHO GLASS, NCBI Pathogen Detection)

India's ICMR AMRSN network represents a model for regional AMR surveillance in resource-limited settings
Understanding Regional Disease Burden
Global burden mapping reveals stark geographical disparities in AMR impact, with Asian and African nations bearing a disproportionate disease burden. These regions face unique challenges including limited access to effective antibiotics, inadequate healthcare infrastructure, and environmental factors that accelerate resistance emergence and spread.
Highest Burden Regions
Sub-Saharan Africa
  • Highest age-standardized mortality rates from AMR
  • Limited access to second-line antibiotics
  • High HIV/TB co-infection rates complicating treatment
  • Weak laboratory infrastructure for resistance detection
South and Southeast Asia
  • Largest absolute number of AMR-attributable deaths
  • High population density accelerating transmission
  • Widespread OTC antibiotic availability
  • Environmental contamination from pharmaceutical manufacturing
  • Emerging resistance hotspots in urban centers
Contributing Factors
  • Healthcare access disparities between urban and rural areas
  • Antibiotic quality issues including substandard and falsified medicines
  • Agricultural practices with unrestricted antimicrobial use
  • Climate factors affecting pathogen transmission dynamics
  • Migration and travel patterns spreading resistant strains
Visualization suggestion: "Heat map showing AMR mortality rates by region with Asia and Africa highlighted"
Regional surveillance systems and priority pathogen lists are essential tools for guiding public health interventions, antimicrobial stewardship programs, and research priorities tailored to local epidemiological contexts.
Indian Priority Pathogen List Framework
India has developed a comprehensive priority pathogen list to guide national AMR surveillance and response efforts. This evidence-based framework identifies critical, high-priority, and medium-priority bacterial pathogens based on mortality burden, transmissibility, antimicrobial resistance patterns, and treatment availability. The list informs diagnostic development, antimicrobial stewardship guidelines, and research investment strategies specific to the Indian epidemiological landscape.
Critical Priority
  • Carbapenem-resistant Enterobacteriaceae
  • Multidrug-resistant Mycobacterium tuberculosis
  • Colistin-resistant Acinetobacter baumannii
High Priority
  • Extended-spectrum β-lactamase-producing E. coli
  • Methicillin-resistant Staphylococcus aureus
  • Fluoroquinolone-resistant Salmonella species
Medium Priority
  • Penicillin-resistant Streptococcus pneumoniae
  • Macrolide-resistant Streptococcus species
  • Vancomycin-resistant enterococci
Mechanisms of Antimicrobial Resistance
Bacteria employ diverse and sophisticated molecular strategies to survive antimicrobial exposure. Understanding these mechanisms at the genetic and biochemical level is fundamental to developing new therapeutic approaches, predicting resistance emergence, and interpreting genomic resistance determinants. Each mechanism represents a distinct evolutionary solution to antibiotic pressure, often encoded by specific gene families amenable to bioinformatic detection.
Enzymatic Inactivation
Enzymes degrade or chemically modify antibiotics through hydrolysis or group transfer reactions. β-lactamases hydrolyze β-lactam rings, while aminoglycoside-modifying enzymes add acetyl, phosphate, or nucleotide groups, preventing target binding.
Target Site Alteration
Mutations in genes encoding antibiotic targets reduce binding affinity. Examples include gyrA/parC mutations conferring fluoroquinolone resistance and ribosomal RNA methylation preventing macrolide binding.
Target Bypass
Alternative pathways or proteins bypass inhibited targets. Acquisition of mecA provides MRSA with an alternative penicillin-binding protein (PBP2a) unaffected by β-lactams, maintaining cell wall synthesis.
Decreased Influx
Reduced membrane permeability limits intracellular antibiotic accumulation. Porin downregulation or structural modification restricts passive diffusion of hydrophilic antibiotics across outer membranes.
Active Efflux
Transmembrane efflux pumps actively export antibiotics from cells. Multi-drug resistance (MDR) efflux systems like AcrAB-TolC in Gram-negatives confer broad-spectrum resistance to structurally diverse compounds.
Target Protection
Protective proteins physically shield antibiotic targets. Ribosomal protection proteins like Tet(O) and Tet(M) dislodge tetracycline from ribosomes, allowing translation to continue despite antibiotic presence.

Clinical Implication: Genomic detection of resistance mechanisms enables prediction of antimicrobial susceptibility profiles from sequence data, facilitating rapid diagnostic workflows and precision antimicrobial therapy.
Mechanisms of Antimicrobial Resistance
Bacteria employ diverse and sophisticated molecular strategies to survive antimicrobial exposure. Understanding these mechanisms at the genetic and biochemical level is fundamental to developing new therapeutic approaches, predicting resistance from genomic data, and implementing effective surveillance programs.
1. Enzymatic Inactivation
  • β-lactamases: These enzymes hydrolyze the β-lactam ring, rendering antibiotics like penicillins and cephalosporins inactive. Key classes include Ambler Classes A (e.g., TEM, SHV, CTX-M ESBLs), B (metallo-β-lactamases like NDM, VIM, IMP), C, and D (OXA-type).
  • Aminoglycoside-modifying enzymes: Such as AAC (aminoglycoside acetyltransferases), APH (aminoglycoside phosphotransferases), and ANT (aminoglycoside nucleotidyltransferases) families, modify aminoglycoside antibiotics, preventing them from binding to their ribosomal targets.
  • Chloramphenicol acetyltransferases (CAT): Inactivate chloramphenicol by acetylation.
  • Detection strategy: Detection often relies on identifying conserved active site motifs and using Hidden Markov Model (HMM) profiles.
2. Target Site Alteration
  • Fluoroquinolone resistance: Primarily due to mutations in genes encoding DNA gyrase (*gyrA*, e.g., S83L, D87N) and topoisomerase IV (*parC*, e.g., S80I, E84K), reducing antibiotic binding affinity.
  • Rifampin resistance: Commonly caused by *rpoB* mutations in the RNA polymerase β-subunit.
  • Macrolide resistance: Often results from mutations in 23S rRNA (e.g., A2058G, A2059G) or acquisition of methyltransferase genes (*erm*), which modify the ribosomal binding site.
  • Isoniazid resistance (in M. tuberculosis): Linked to *katG* mutations (e.g., S315T), which impair the enzyme responsible for activating the prodrug isoniazid.
  • Detection challenge: Accurate detection requires comprehensive, species-specific catalogs of known resistance-conferring mutations.
3. Target Bypass (Alternative Pathways)
  • mecA/mecC in MRSA: Acquisition of these genes leads to the production of PBP2a, an alternative penicillin-binding protein with low affinity for β-lactam antibiotics, allowing cell wall synthesis to continue.
  • vanA/vanB in VRE: These genes mediate the synthesis of D-Ala-D-Lac peptidoglycan precursors, which vancomycin cannot bind effectively.
  • sul genes: Encode sulfonamide-insensitive dihydropteroate synthase, bypassing the inhibited enzyme.
  • dfr genes: Encode trimethoprim-resistant dihydrofolate reductase, providing an alternative target for folate synthesis.
  • Genetic context: These bypass mechanisms are often carried on mobile genetic elements, facilitating their rapid spread, and feature highly conserved sequences.
4. Reduced Permeability
  • Porin loss or modification: Downregulation or structural changes in outer membrane porins (e.g., OmpK35/36 in Klebsiella) restrict the entry of hydrophilic antibiotics, particularly relevant for carbapenem resistance.
  • Lipopolysaccharide modifications: Alterations to the lipopolysaccharide layer can also decrease antibiotic penetration.
  • Reduced outer membrane permeability: Generally limits intracellular antibiotic accumulation, acting as a crucial barrier.
5. Efflux Pump Overexpression
  • Transmembrane efflux pumps: These actively export antibiotics from the bacterial cell, reducing their intracellular concentration.
  • Major superfamilies: Include Resistance-Nodulation-Cell Division (RND) family pumps (e.g., AcrAB-TolC in E. coli), Major Facilitator Superfamily (MFS), ATP-binding cassette (ABC), Multidrug And Toxic Compound Extrusion (MATE), and Small Multidrug Resistance (SMR) superfamilies.
  • Broad substrate specificity: Many efflux pumps can extrude a wide range of structurally diverse compounds, conferring multi-drug resistance.
  • Genetic control: These pumps can be encoded on chromosomal DNA or plasmids, and their expression is often regulated.
6. Biofilm Formation
  • Extracellular matrix protection: Bacteria encased in biofilms are protected by a polymeric matrix that physically hinders antibiotic penetration.
  • Reduced antibiotic penetration: The dense structure of biofilms impedes the diffusion of antibiotics, leading to lower effective concentrations at the bacterial cell surface.
  • Persister cell formation: Biofilms promote the development of metabolically inactive persister cells, which are tolerant to high concentrations of antibiotics.
  • Quorum sensing regulation: Cell-to-cell communication within biofilms (quorum sensing) plays a role in regulating biofilm structure and resistance mechanisms.

Clinical Implication: Genomic detection focuses primarily on mechanisms 1-3, which have well-characterized genetic determinants amenable to bioinformatic analysis, enabling prediction of antimicrobial susceptibility profiles from sequence data.
Key Databases for AMR & Virulence Prediction
Comprehensive and curated reference databases are foundational to accurate AMR and virulence prediction from genomic data. These resources integrate experimental validation, sequence curation, and phenotypic linkage to enable reliable resistance profiling.
1
CARD: Comprehensive Antibiotic Resistance Database
The most comprehensive and widely adopted AMR gene database, CARD integrates the Antibiotic Resistance Ontology (ARO) with curated resistance gene sequences.
  • Largest collection: >6,000 resistance genes and variants
  • Antibiotic Resistance Ontology (ARO) for structured classification
  • Detection models: Protein homolog, protein variant, rRNA gene variant
  • RGI tool with three stringency modes: Perfect (100% ID), Strict (>95% ID), Loose (divergent homologs)
  • Integration with DIAMOND for accelerated alignment
  • Monthly updates with literature curation
2
NCBI AMRFinderPlus
Maintained by the National Center for Biotechnology Information, AMRFinderPlus emphasizes clinically relevant resistance genes and chromosomal mutations, integrated with NCBI Pathogen Detection infrastructure.
  • Clinical and surveillance focus with high specificity
  • Dual detection strategy: BLAST for acquired genes, HMM for divergent homologs
  • Species-specific chromosomal mutation panels for 40+ organisms
  • Integrated with NCBI Pathogen Detection platform
  • Monthly database updates with standardized reporting format
  • Includes stress response and virulence factors
3
ResFinder and PointFinder (CGE Services)
Developed by the Center for Genomic Epidemiology, ResFinder focuses on acquired resistance genes, while PointFinder handles chromosomal mutation analysis.
  • ResFinder: Acquired resistance genes (default ≥90% ID, ≥60% coverage)
  • PointFinder: Species-specific chromosomal mutations (E. coli, Salmonella, Campylobacter, etc.)
  • User-friendly web interface with batch submission support
  • Biannual database updates with expert manual curation
  • Command-line versions available for local high-throughput analysis
  • Phenotype prediction integrated
4
MEGARes - Metagenomic AMR Database
Specifically designed for metagenomic AMR annotation, MEGARes employs hierarchical gene classification for resistome profiling in complex microbial communities.
  • Hierarchical classification: Class → Mechanism → Group → Gene
  • Optimized for metagenomic shotgun sequencing applications
  • Integration with AMR++ analysis pipeline
  • Reduced false positives in complex microbial communities
  • Applications: Environmental resistome, microbiome studies, One Health surveillance
5
Additional Specialized Databases
  • VFDB: Virulence Factor Database
  • Virulent2: Machine learning-based virulence prediction
  • PlasmidFinder: Plasmid replicon typing
  • ARG-ANNOT: Antibiotic Resistance Gene-ANNOTation
Database Selection and Integration Strategies
Choosing the Right Tool for Your Analysis
Selection of appropriate databases and prediction tools depends on multiple factors including study objectives (surveillance vs. research), target organisms, computational resources, and required turnaround time. Understanding the strengths and limitations of each approach enables optimal tool selection and result interpretation.
For Clinical Diagnostics:
  • Primary: AMRFinderPlus (high specificity, clinical focus)
  • Validation: ResFinder for phenotype prediction
  • Turnaround: <30 minutes per genome
  • Reporting: High-confidence calls only (≥95% ID, ≥90% coverage)
For Research and Surveillance:
  • Primary: CARD RGI (comprehensive coverage)
  • Comparative: ABRicate multi-database screening
  • Analysis depth: Include loose/divergent hits for novel variant discovery
  • Integration: Combine with phylogenetic and epidemiological data
For Metagenomic Studies:
  • Primary: MEGARes with AMR++ pipeline
  • Considerations: Taxonomic assignment, abundance normalization
  • Applications: Environmental monitoring, microbiome resistome
Tool Comparison Matrix
Integration Best Practices
  • Use multiple tools for cross-validation of critical findings
  • Prioritize genes detected by ≥2 databases (high confidence)
  • Investigate database-specific calls for nomenclature differences
  • Correlate predictions with phenotypic AST when available
  • Document tool versions and database dates for reproducibility
Sample Datasets for Analysis
These sample datasets represent crucial Klebsiella pneumoniae isolates, essential for antibiotic resistance research and genomic surveillance. They provide a foundation for understanding the genetic basis of resistance and tracking pathogen evolution, enabling deeper insights into resistance mechanisms and epidemiological trends.
Klebsiella pneumoniae Isolate 1
This dataset provides genomic information for a specific Klebsiella pneumoniae isolate, critical for studying its genetic makeup and resistance profile.
NCBI RefSeq assembly: GCF_051549635.1
Submitted GenBank assembly: GCA_051549635.1
Klebsiella pneumoniae Isolate 2
Another valuable dataset offering insights into a distinct Klebsiella pneumoniae isolate, supporting comparative genomic analysis.
NCBI RefSeq assembly: GCF_051414815.1
Submitted GenBank assembly: GCA_051414815.1

www.ncbi.nlm.nih.gov

NCBI - WWW Error Blocked Diagnostic

Your access to the NCBI website at www.ncbi.nlm.nih.gov has been temporarily blocked due to a possible misuse/abuse situation involving your site. This is not an indication of a security issue such as a virus or attack. It could be something as simple as a run away script or learning how to better use E-utilities, http://www.ncbi.nlm.nih.gov/books/NBK25497/, for more efficient work such that your work does not impact the ability of other researchers to also use our site. To restore access and un

Download of sequences
Get FTP links
wget https://ftp.ncbi.nlm.nih.gov/genomes/all/GCF/051/549/635/GCF_051549635.1_ASM5154963v1/GCF_051549635.1_ASM5154963v1_genomic.fna.gz 
wget https://ftp.ncbi.nlm.nih.gov/genomes/all/GCF/051/414/815/GCF_051414815.1_KpMVS2/GCF_051414815.1_KpMVS2_genomic.fna.gz 
gunzip GCF_051414815.1_KpMVS2_genomic.fna.gz 402 gunzip GCF_051549635.1_ASM5154963v1_genomic.fna.gz
Hands-on Exercise: AMRFinderPlus Analysis
Introduction to AMRFinderPlus
AMRFinderPlus is NCBI's flagship tool for identifying antimicrobial resistance genes, stress response genes, and virulence factors in bacterial genomes and proteins. It uses BLAST and hidden Markov model searches against curated reference databases to detect both acquired resistance genes and chromosomal point mutations. This hands-on exercise demonstrates standard workflows for bacterial genome analysis.
01
Database Preparation
Update the AMRFinderPlus reference database to ensure detection of recently characterized resistance determinants
02
Basic Analysis
Execute nucleotide-based detection against provided Klebsiella pneumoniae genome assemblies
03
Result Interpretation
Examine tabular output for resistance genes, percent coverage, and identity metrics
Database Update Command

Always update the AMRFinderPlus database before analysis to ensure current reference sequences and interpretation rules. Database updates are released monthly.
amrfinder --update
Genome Analysis Workflow
We'll analyze two Klebsiella pneumoniae genome assemblies to identify their AMR gene repertoires and predict antimicrobial susceptibility patterns. These clinical isolates represent multidrug-resistant strains with complex resistance profiles.
Sample 1: K. pneumoniae MVS2
amrfinder -n /home/JNLab_Repo/hands-on/3a/GCF_051414815.1_KpMVS2_genomic.fna \
--output kp_mvs2_amr_results.tsv
Sample 2: K. pneumoniae ASM5154963v1
amrfinder -n /home/JNLab_Repo/hands-on/3a/GCF_051549635.1_ASM5154963v1_genomic.fna \
--output kp_asm_amr_results.tsv
Input Files
  • FASTA-formatted genome assemblies
  • Contigs or complete chromosomes
  • Minimum recommended N50 > 10 kb
Output Columns
  • Gene symbol and sequence name
  • Scope (core/plus), element type, subtype
  • Drug class and resistance phenotype
  • Percent coverage and identity to reference
  • Genomic location and strand orientation
Interpretation Tip: Focus on genes with ≥90% identity and ≥80% coverage for high-confidence calls. Lower thresholds may indicate divergent alleles or partial genes requiring manual review.
Hands-on Exercise: RGI (Resistance Gene Identifier)
CARD RGI Analysis Pipeline
The Resistance Gene Identifier (RGI) is CARD's primary tool for AMR gene prediction. It employs a dual-mode detection strategy: strict mode for high-confidence matches to curated reference sequences, and loose mode detecting more divergent homologs. RGI's protein variant models enable detection of specific resistance-conferring mutations in key chromosomal targets.
Environment Setup
Create isolated conda environment to manage RGI dependencies
Tool Installation
Install RGI from Bioconda channel with all required dependencies
Genome Analysis
Execute RGI with contig-mode analysis and automatic cleanup
Step-by-Step Command Workflow
1. Create Conda Environment
Establish a new conda environment named "tool" for RGI installation. The -y flag automatically confirms the environment creation without prompting.
conda create -n tool -y
2. Activate Environment
Activate the newly created environment to isolate RGI dependencies from other system packages, preventing version conflicts.
conda activate tool
3. Install RGI
Install the Resistance Gene Identifier from the Bioconda channel. This command automatically resolves and installs all required dependencies including BLAST+, Prodigal, and DIAMOND.
conda install bioconda::rgi
4. Run RGI Analysis
Execute RGI on the K. pneumoniae MVS2 genome assembly using contig mode for draft genomes. The --clean flag removes intermediate files after analysis completion.
rgi main -i /home/JNLab_Repo/hands-on/3a/GCF_051414815.1_KpMVS2_genomic.fna \
-o rgi_output \
-t contig \
--clean
Key Parameters
  • -i: Input genome assembly file
  • -o: Output file prefix
  • -t contig: Analysis mode for assembled contigs
  • --clean: Remove temporary files
Output Files
  • rgi_output.txt: Primary results table
  • rgi_output.json: Machine-readable JSON format
  • ORF prediction files (if not cleaned)
  • BLAST alignment details
Understanding RGI Detection Modes
Perfect Hits
100% identity to curated reference sequences, indicating exact allele matches with known resistance phenotypes
Strict Hits
High similarity to curated AMR sequences, typically >95% identity with functional domain conservation
Loose Hits
Lower similarity matches that may represent divergent homologs or novel variants requiring validation
Web-based Analysis Tools: ResFinder and AMRProfiler
Browser-based AMR Prediction Platforms
Web-based tools provide accessible alternatives to command-line workflows, offering user-friendly interfaces for single-genome analysis without requiring local software installation or computational infrastructure. These platforms are ideal for exploratory analysis, educational purposes, and laboratories lacking bioinformatics expertise. However, they typically impose upload limits and are less suitable for high-throughput surveillance applications.
ResFinder
Comprehensive acquired resistance gene identification with integrated PointFinder for chromosomal mutations
AMRProfiler
Multi-tool integration platform combining multiple databases for comprehensive resistance profiling
ResFinder Analysis Features
Acquired Resistance Genes
The primary ResFinder module detects horizontally acquired AMR genes through BLAST-based homology searches against curated databases. Users can adjust detection thresholds for coverage and identity percentage, balancing sensitivity and specificity based on analytical needs.
  • Customizable identity threshold (default 90%)
  • Minimum coverage filtering (default 60%)
  • Species-specific database selection
  • Batch upload for multiple genomes
PointFinder Integration
PointFinder complements acquired gene detection by identifying chromosomal mutations conferring resistance. This module focuses on well-characterized resistance mechanisms in genes like gyrA, parC, and ribosomal targets.
  • Species-specific mutation databases
  • Known resistance-conferring SNPs
  • Integration with acquired gene results
  • Predicted phenotypic resistance profiles
AMRProfiler Workflow
AMRProfiler aggregates results from multiple resistance prediction tools including CARD RGI, ResFinder, and AMRFinderPlus, providing comparative analysis across databases. This multi-tool approach maximizes detection sensitivity and helps identify database-specific calls requiring further investigation.
1
Upload Genome
Submit assembled FASTA or raw reads
2
Tool Selection
Choose which databases to query
3
Automated Analysis
Parallel execution across tools
4
Integrated Results
Unified resistance profile report

Practical Exercise: Upload one of the provided K. pneumoniae genomes to both ResFinder and AMRProfiler. Compare the detected resistance genes across platforms and note any database-specific calls. Consider how tool selection impacts clinical interpretation.
ABRicate: Multi-Database Resistance Screening
Comprehensive Multi-Database AMR Annotation
ABRicate is a versatile command-line tool enabling rapid screening of assembled genomes against multiple AMR and virulence factor databases simultaneously. Its strength lies in database integration, allowing users to query CARD, ResFinder, ARG-ANNOT, NCBI AMRFinderPlus, MEGARes, EcOH, PlasmidFinder, Ecoli_VF, and VFDB from a unified interface. This comparative approach reveals database-specific coverage and facilitates comprehensive resistance characterization.
Installation and Database Overview
conda install bioconda::abricate
After installation, view available databases and their gene counts using the list command:
abricate --list
Basic Analysis Workflow
Execute ABRicate against individual databases to compare their detection capabilities. The default output is tab-delimited, facilitating downstream parsing and integration with custom pipelines.
01
CARD Database Analysis
Query against the Comprehensive Antibiotic Resistance Database for ontology-based resistance annotation
02
ResFinder Database Analysis
Screen for acquired resistance genes with CGE-curated sequences and interpretation
03
ARG-ANNOT Database Analysis
Detect resistance genes with alternative nomenclature and classification schema
04
Result Comparison
Identify concordant calls across databases and investigate database-specific detections
Multi-Database Execution Commands
CARD Analysis
abricate --db card /home/JNLab_Repo/hands-on/3a/GCF_051414815.1_KpMVS2_genomic.fna > card_results.tab
ResFinder Analysis
abricate --db resfinder /home/JNLab_Repo/hands-on/3a/GCF_051414815.1_KpMVS2_genomic.fna > resfinder_results.tab
ARG-ANNOT Analysis
abricate --db argannot /home/JNLab_Repo/hands-on/3a/GCF_051414815.1_KpMVS2_genomic.fna > argannot_results.tab
Output Interpretation
ABRicate generates tabular output with standardized columns facilitating comparative analysis. Each detected resistance determinant includes quality metrics essential for confident annotation.
Analysis Strategy: Execute ABRicate against multiple databases and compare results. High-confidence calls appear across databases with consistent coverage and identity metrics. Database-specific hits may represent novel variants, database annotation differences, or false positives requiring manual curation.
Advantages
  • Unified interface for multiple databases
  • Rapid screening suitable for large datasets
  • Standardized tabular output
  • Easy integration into custom pipelines
Considerations
  • Requires local database installation
  • Manual database updates needed
  • Default thresholds may need adjustment
  • Limited mutation detection capabilities
Virulence Prediction
Virulent2 is a web-based tool developed by ICGEB (International Centre for Genetic Engineering and Biotechnology) for predicting virulence factors in bacterial genomes using machine learning approaches. Access: https://bioinfo.icgeb.res.in/virulent2/index.html
What Does Virulent2 Do?
  • Predicts virulence-associated proteins in bacterial genomes
  • Uses Support Vector Machine (SVM) models trained on known virulence factors
  • Analyzes protein sequences to identify potential pathogenicity determinants
  • Complements AMR analysis for complete pathogen profiling
Key Features:
  • ✅ Whole genome or individual protein analysis
  • ✅ Multiple bacterial species models
  • ✅ Both sequence-based and BLAST-based predictions
  • ✅ Downloadable results
  • ✅ Free to use (no registration required)
Preparing Your Data Input Requirements:
Option 1: Protein Sequences (FASTA format)
protein_1 MKKLLVTSLVVAFSSASAAEKVLTQSPAIMSASPGEKVTINCTASSSVSYMHWYQQKSG ASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQWNSSPLTFGA GTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGV Option 2: Genome Sequence (FASTA format) contig_001 ATGAAACAATTAATTGTCACGAGCCTGGTGGTGGCGTTCTCTTCGGCAAGTGCCGCAGAA AAAGTTTTAACCCAGTCACCAGCAATTATGTCCGCATCACCAGGCGAAAAGTAACTA Where to Get Test Data:
Where to Get Test Data:
NCBI Protein Database
Search for your organism: e.g., "Escherichia coli O157:H7" Download protein FASTA sequences
Sample Pathogens for Practice:
E. coli O157:H7 (EHEC) - toxin-producing Salmonella enterica - invasive pathogen Staphylococcus aureus - multiple virulence factors Vibrio cholerae - cholera toxin producer
NCBI Example Accessions:
E. coli O157:H7: GCF_000008865.2 S. aureus MRSA: GCF_000013425.1
Part 3: Step-by-Step Tutorial Tutorial 1: Single Protein Analysis Step 1: Access the Tool
Navigate to https://bioinfo.icgeb.res.in/virulent2/index.html Read the homepage information about prediction methods
Step 2: Prepare Test Sequence
Let's use Shiga toxin subunit A from E. coli O157:H7 as an example:
stx2A_Shiga_toxin_subunit_A MKNLIFKASLALSLSALSVAAHAAESGFTSESQFEVYDQSFSSQPGHTFLLIPGGDCP VKDPQDTTIPQQPDPGSGTSTTTTQQHPVLFQAQQLFTSGKDPGDRFQVKQLSFFTRL ERAGTDRSARTDDPSEDSYYLQSDPGDTRDPLGLTLALGGSASVDQVRLVTLDFQFSQ FGAVIGQEKISNREITSYLFEVDVGGTLQIFGQRFAKTRQFGVQVDDATKQYTVLQTD FTWILAFNTGWIGKVFQRFSRPMLFPFVKASIAFYQQSRFPLTQQQIFEQAGFGGLGL KLRDLMAKVYQALDRKGSLSLAVFPNQSSEVLEKGFGVNSSMGFGGSAPLLRQAVSPV STYFH Step 3: Submit Analysis
Step 3: Submit Analysis
Click on "Submit" or "Predict" button Choose "Sequence-based prediction" (default) Paste your sequence in the text box Select organism/model if applicable (may have E. coli specific model) Click "Submit" or "Predict"
Step 4: Interpret Results
Expected Output Fields:
Prediction: Virulent / Non-virulent Score/Probability: Confidence of prediction (0-1 or percentage) Classification: Type of virulence factor (if specified) Similar proteins: BLAST hits to known virulence factors
For Shiga toxin, you should see:
✅ Prediction: VIRULENT
✅ Score: High confidence (>0.8)
✅ Function: Toxin/cytotoxin
✅ Mechanism: Protein synthesis inhibitor
Best Practices & Tips
1
✅ DO:
Use high-quality genome assemblies Set appropriate score thresholds (≥0.7-0.8) Validate high-impact predictions Integrate with AMR and typing data Update databases regularly Document software versions
2
❌ DON'T:
Trust low-confidence predictions (<0.5) Report every predicted virulence factor clinically Ignore housekeeping genes flagged as virulent Use incomplete/fragmented sequences Make clinical decisions on predictions alone
🎯 Pro Tips:
1
Compare across databases:
Use VFDB, VFanalyzer, and Virulent2 together
2
Check literature:
PubMed search for predicted virulence genes
3
Context matters:
Same gene may have different roles in different species
4
Evolution:
Pathogens acquire/lose virulence factors - always verify
5
False positives:
Homologs to virulence factors aren't always virulent
Additional Resources
Databases:
VFDB: Virulence Factor Database Victors: Virulence Factors of Pathogenic Bacteria PHI-base: Pathogen-Host Interactions database
Learning Resources:
ICGEB Bioinformatics tutorials NCBI Pathogen Detection portal EBI Pathogenomics training
Resources and Best Practices for AMR Analysis
Free Analysis Platforms and Educational Resources
Numerous no-cost resources support AMR genomic analysis, making sophisticated bioinformatics accessible to laboratories with limited budgets or computational infrastructure. These platforms balance ease-of-use with analytical depth, though users should understand inherent limitations in throughput, customization, and data privacy.
Galaxy Platform
Web-based workflow management system providing AMR analysis tools including RGI, ABRicate, and custom pipelines. Supports reproducible analysis with workflow sharing and no installation requirements.
CGE Server Tools
Free-to-use web services from the Center for Genomic Epidemiology including ResFinder, PointFinder, PlasmidFinder, and additional typing tools. Academic use is unrestricted; commercial users should consult licensing terms.
NCBI Pathogen Detection
Public surveillance platform integrating genome sequencing, AMR prediction, and cluster detection. Provides standardized SNP-based phylogenetic analysis and AMRFinderPlus results for uploaded genomes.
Tutorial Datasets
Curated training datasets from NCBI, European Nucleotide Archive (ENA), and tool developers provide standardized inputs for workflow validation and method comparison.
Analysis Best Practices
Rigorous AMR genomic analysis demands attention to quality control, database currency, and contextual interpretation. Following established best practices ensures reproducible results and appropriate clinical or research conclusions.
Maintain Current Databases
AMR databases undergo frequent updates incorporating newly characterized resistance genes and refined interpretation rules. Establish routine update schedules (minimally quarterly) and document database versions in analysis metadata. Outdated databases may miss emergent resistance mechanisms critical for surveillance and clinical care.
Integrate Phenotypic Validation
Genomic predictions should be correlated with phenotypic susceptibility testing whenever possible. Discordance between genotype and phenotype may indicate novel resistance mechanisms, cryptic genes requiring functional validation, or laboratory testing errors. Major discrepancies warrant investigation and potential reporting to database curators.
Document Analytical Provenance
Comprehensive documentation ensures reproducibility and facilitates troubleshooting. Record software versions, database dates, parameter settings, quality control metrics, and processing dates. Version control systems like Git combined with workflow managers (Nextflow, Snakemake) enable traceable, reproducible analyses.
Consider Population Context
Resistance gene prevalence and clinical significance vary geographically and across bacterial populations. Interpretation should incorporate local epidemiology, prevalent clones, and regional antibiotic usage patterns. Rare variants in specific populations may be common elsewhere, affecting predictive accuracy.
Understand Regional Epidemiology
Regional AMR burden, particularly in high-burden Asian and African settings highlighted in surveillance data, demands context-specific interpretation. Local resistance mechanisms, prevalent clones (e.g., high-risk E. coli ST131 or K. pneumoniae ST258), and antibiotic availability patterns inform appropriate genomic predictions and stewardship interventions.
Quality Control Checkpoints
Pre-Analysis QC
  • Verify assembly quality metrics (N50, L50, completeness)
  • Confirm species identification through taxonomic classifiers
  • Assess contamination using CheckM or similar tools
  • Evaluate coverage depth and uniformity
Post-Analysis QC
  • Review coverage and identity percentages for detected genes
  • Investigate genes on short contigs or at contig boundaries
  • Validate unexpected resistance profiles
  • Cross-reference with epidemiological data
Software Installation and Technical Setup
Pre-Session Installation Requirements
Participants should establish a functional bioinformatics environment prior to hands-on exercises. This section outlines recommended software installation procedures for both local command-line analysis and web-based alternatives. For command-line tools, conda/bioconda package management is strongly recommended to handle complex dependency chains and version management.
Install Core Dependencies
Conda package manager and BLAST+ suite form the foundation for most AMR prediction tools
Install AMR Prediction Tools
ABRicate, AMRFinderPlus, and RGI provide complementary detection capabilities
Verify Installation
Test each tool with example data to confirm proper configuration
Update Databases
Download current reference databases before analysis begins
Recommended Local Software Installation
The following tools should be installed and tested prior to the workshop. Installation via conda is recommended for simplified dependency management and consistent versioning.
ABRicate
Multi-database screening tool with integrated BLAST functionality
conda install -c bioconda abricate
abricate --check
AMRFinderPlus
NCBI's comprehensive resistance gene identifier with point mutation detection
conda install -c bioconda ncbi-amrfinderplus
amrfinder --update
amrfinder --check
BLAST+ Suite
Fundamental sequence alignment tools used by most AMR prediction software
conda install -c bioconda blast
blastn -version
RGI (Optional)
CARD's Resistance Gene Identifier for detailed mechanism annotation
conda install -c bioconda rgi
rgi main --version
Web-based Platform Alternatives
For participants unable to install local software or those preferring browser-based workflows, the following platforms provide comparable functionality without installation requirements. These services are free for academic use but may have upload limitations and queue times during peak usage.
ResFinder Web Server
User-friendly interface for acquired gene and point mutation detection
CARD RGI Portal
Web-based access to the Comprehensive Antibiotic Resistance Database
BV-BRC Workbench
Comprehensive bacterial bioinformatics platform with integrated AMR prediction
PathogenWatch
Automated genomic surveillance platform with AMR and virulence profiling
Pre-configured Conda Environment (Optional)
For streamlined setup, participants may create a unified conda environment containing all required tools. This approach ensures version compatibility and simplifies activation.
conda create -n amr_workshop -c bioconda \
  abricate \
  ncbi-amrfinderplus \
  blast \
  rgi \
  python=3.9

conda activate amr_workshop

# Update databases
amrfinder --update
abricate --setupdb

Troubleshooting Resources: Installation issues often stem from dependency conflicts or channel priorities. Consult tool-specific documentation, Bioconda issue trackers, or workshop facilitators for assistance. Common solutions include creating fresh environments or specifying explicit version constraints.
Dataset Sources for Training and Validation
Curated Datasets for AMR Analysis Training
High-quality, well-characterized genomic datasets are essential for tool validation, method comparison, and skills development. The following repositories provide publicly accessible bacterial genomes with comprehensive metadata, enabling realistic training scenarios and benchmarking exercises. Selection of appropriate datasets should consider organism diversity, resistance profile complexity, and analysis objectives.
NCBI Pathogen Detection
The National Center for Biotechnology Information maintains a comprehensive pathogen genomics surveillance system containing tens of thousands of bacterial isolates from clinical and environmental sources worldwide. Each isolate includes standardized AMRFinderPlus results, SNP-tree placement, and detailed metadata facilitating epidemiological analysis.
  • Real outbreak investigation genomes with clinical context
  • Standardized quality control and assembly metrics
  • Pre-computed AMR predictions enabling workflow validation
  • Integration with PubMLST and other typing databases
  • Bulk download capabilities via SRA toolkit and NCBI datasets
BV-BRC (Bacterial and Viral Bioinformatics Resource Center)
Formerly known as PATRIC, BV-BRC provides curated bacterial and viral genomes with rich functional annotations, metabolic reconstructions, and integrated analysis tools. The platform emphasizes user-friendly access to complex genomic data and streamlined analysis workflows suitable for researchers at all expertise levels.
  • Manually curated reference genomes with expert annotation
  • Comprehensive metadata including antimicrobial susceptibility testing results
  • Built-in analysis services for AMR, comparative genomics, and phylogenetics
  • Specialized collections for priority pathogens and AMR research
  • Educational tutorials and example datasets for training
European Nucleotide Archive (ENA)
ENA serves as Europe's primary nucleotide sequence repository, providing comprehensive access to raw sequencing reads, assembled genomes, and associated metadata. The archive supports FAIR data principles and interoperates with international sequence databases through INSDC coordination.
  • Raw sequencing reads enabling custom assembly pipelines
  • Comprehensive study metadata and sample attributes
  • Advanced search capabilities across taxonomic and experimental dimensions
  • Programmatic access via REST APIs and FTP
  • Integration with EMBL-EBI analysis services
Tool-Specific Test Datasets
Software developers often provide curated test datasets demonstrating expected functionality and serving as positive controls. These datasets typically include genomes with well-characterized resistance profiles enabling validation of local installations and comparison of analysis parameters.
  • CARD RGI test genomes with known resistance determinants
  • AMRFinderPlus validation datasets from NCBI
  • ResFinder example submissions with expected outputs
  • Published benchmark datasets from methods comparison studies
  • Tutorial datasets from workshops and training courses
Dataset Selection Criteria
Training Considerations
  • Diverse species representation across Gram-positive and Gram-negative bacteria
  • Range of resistance profiles from susceptible to extensively drug-resistant
  • High-quality assemblies meeting N50 and completeness thresholds
  • Available phenotypic antimicrobial susceptibility testing data
Validation Requirements
  • Previously published genomes with peer-reviewed analysis
  • Known resistance mechanisms confirmed experimentally
  • Complete metadata including isolation source and date
  • Representation of locally relevant pathogens and resistance patterns
Best Practice for Dataset Selection: Begin training with well-characterized reference genomes from tool developers, then progress to real outbreak isolates from NCBI Pathogen Detection. This approach builds confidence in interpretation while introducing realistic complexity including mixed populations, novel variants, and incomplete resistance profiles.